SKU: 33572648505

Human Doublecortin, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 24 - Jul 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Doublecortin, His tagProduct Specification Species Human Synonyms Doublin, Lissencephalin X (Lis X), DCX, DBCN, LISX Accession O43602 Amino Acid Sequence Protein sequence (O43602, Asn269 Ser360, with C 10*His) NECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSLDDSDSGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Predicted MW: 11. 4 kDa Observed MW: 16 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical

Product Specification


Species Human
Synonyms Doublin, Lissencephalin-X (Lis-X), DCX, DBCN, LISX
Accession O43602
Amino Acid Sequence

Protein sequence (O43602, Asn269-Ser360, with C-10*His) NECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSLDDSDSGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 11.4 kDa Observed MW: 16 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Doublecortin (DCX) is a microtubule-associated protein expressed by neuronal precursor cells and immature neurons in embryonic and adult cortical structures. In vivo and in vitro assays show that Doublecortin stabilizes microtubules and causes bundling. Doublecortin is a basic protein with an iso-electric point of 10 typical of microtubule-binding proteins. Doublecortin is mutated in X-linked lissencephaly and the double cortex syndrome, and the clinical manifestations are sex-linked. In males, X-linked lissencephaly produces a smooth brain due to lack of migration of immature neurons, which normally promote folding of the brain surface. Double cortex syndrome is characterized by abnormal migration of neural tissue during development which results in two bands of misplaced neurons within the subcortical white, generating two cortices, giving the name to the syndrome; this finding generally occurs in females. At least 49 disease-causing mutations in this gene have been discovered.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 33572648505

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
Paisley Stewart
West Palm Beach, US
★★★★★ 5
A Game Changer for Sensitive Skin
I use this serum every single day, and it has become one of the most important products in my skincare routine. I have very sensitive skin and cannot tolerate stronger active ingredients such as retinol or high-strength acids, so finding something effective but gentle has been incredibly important. This serum has helped calm redness, reduce inflammation, and noticeably improve my skin’s overall appearance and comfort. After dealing with a prolonged inflammatory skin condition, this product made a significant difference and helped restore my skin barrier. The formula feels soothing, hydrating, and non-irritating. If you have sensitive or reactive skin and are looking for a gentle product to help with redness and uneven texture, I highly recommend giving this serum a try. Photos attached: The green bottle is the product and the second photo includes my favorite additions.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
B
Verified Purchase
Bri M.
Birmingham, US
★★★★★ 5
Perfect for Acne-Prone Skin!
This serum has honestly been a great addition to my routine for redness and post-acne marks. The texture is lightweight, hydrating, and doesn’t feel sticky or heavy on my oily/acne-prone skin. I have sensitive skin with a focus on barrier protection, and this didn’t irritate my skin at all. It layers beautifully with the rest of my skincare and leaves my skin looking calmer and smoother over time. AND, it doesn’t have a smell!! Definitely one of my favorite azelaic acid serums I’ve tried.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
L
Verified Purchase
Leyla Leiva
Lowell, US
★★★★★ 5
6-Month Update: Still a staple for sensitive, acne-prone skin
Size: 3.38 Fl Oz (Pack of 1), Size: 3.38 Fl Oz (Pack of 1)
I originally reviewed this ampoule when I first started using it, and now after about six months of consistent use (morning and night), I feel confident giving a more long-term update. I have sensitive, acne-prone, combination skin, and this has remained one of the most reliable products in my routine. The texture is still one of my favorite things about it — very lightweight, absorbs quickly, and layers well under moisturizer and sunscreen without pilling. Over time, I’ve noticed: Less visible redness More balanced oil production in my T-zone Fewer irritation flare-ups when introducing new products No clogged pores or breakouts from this formula It doesn’t feel heavy or sticky, even in humid weather. I’ve continued repurchasing and even keep it on subscription because it consistently performs without causing sensitivity. If you’re looking for a gentle, soothing centella product that works well for long-term barrier support, this has proven to be a dependable option in my experience.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 9, 2025
D
Verified Purchase
Daegon
Grantham, US
★★★★★ 5
Healed my barrier so fast
Size: 3.38 Fl Oz (Pack of 1)
I received this ampoule yesterday and I'm already leaving a 5 star review after 2 uses because it just worked so well. I bought it because I've recently incorporated the Timeless 20% Vitamin C into my routine and that + my tretinoin made my skin drier than I've ever felt it before, even gently swiping a cotton pad with micellar would sting on some parts of my face. As soon as this ampoule arrived I applied it to clean skin and layered squalane on top (my moisturizer was burning as well.) This product did not sting my face AT ALL. It instead felt immediately soothing and hydrating. When I woke up this morning almost all of my redness was gone, my skin didn't feel tight or irritated, and my skin tone looked so even and glowy. I never thought a product, especially such a simply formulated one, could heal my barrier so quickly but that's exactly what it did and I can already tell it's a repeat buy. If you have redness prone sensitive skin and/or you use several high strength actives, this ampoule is a must have and it might be the key for anyone struggling to tolerate high strength retinoids. I got the largest size bottle for $15 on sale and it's seriously one of the most affordable and effective skincare products I've ever had in my routine.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
L
Verified Purchase
Luffy’s Mom I Real Life Tester
Grantham, US
★★★★★ 5
Safe, Lightweight, Hydrating – Perfect for sensitive, super oily, acne-prone skin
Size: 1.85 Fl Oz (Pack of 1), Size: 1.85 Fl Oz (Pack of 1)
I care most about the ingredients, and this Madagascar Centella Ampule is excellent — all the ingredients are safe, with no potential harm to your health, and it’s Yuka app approved with a 100/100 safety score. I feel confident using it on my sensitive, super oily, acne-prone skin. It’s super lightweight, absorbs quickly, and is not sticky at all — after applying, you just feel comfortable hydration. Even after a few hours, my skin doesn’t get oily, unlike some other serums I’ve used. It helps calm my skin and restore the barrier, which is perfect for my skin type. Even when I have acne wounds, it doesn’t irritate or sting — it’s extremely gentle. For sensitive, super oily, acne-prone skin like mine, it works wonderfully. Living in Utah, one of the driest states in the U.S., this serum keeps my skin hydrated even in very dry conditions, and a little goes a long way — 1–1.5 drops cover my face and neck. Using more can make my skin slightly oily, so just the right amount works perfectly. For someone with dry skin, results may differ, but for my skin type, it works beautifully. It’s also super affordable, and I’m glad it’s available on Amazon, with occasional great deals at Costco. I appreciate that it’s accessible at this price because this serum helps my skin a lot — very gentle on my acne-prone, sensitive, super oily skin. The serum is super easy to apply with the dropper, which keeps other things from getting into the bottle — it’s perfect for easy, hygienic application. Just note that the bottle is glass, so be careful — it may break if dropped. I’ve only been using it for three weeks, but it’s already a staple. I currently use one bottle, and the other two are extra for long-term use, especially since I got them on a great deal. This is now my main hydration serum, and I’ll update after longer use if needed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 19, 2026

recommand products