SKU: 49936164018

Human Reg4, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 17 - Jul 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Reg4, His tagProduct Specification Species Human Synonyms Gastrointestinal secretory protein, REG like protein, Regenerating islet derived protein IV (Reg IV), GISP, RELP Accession Q9BYZ8 Amino Acid Sequence Protein sequence (Q9BYZ8, Asp23 Pro158, with C 10*His) DIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRPGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted

Product Specification


Species Human
Synonyms Gastrointestinal secretory protein, REG-like protein, Regenerating islet-derived protein IV (Reg IV), GISP, RELP
Accession Q9BYZ8
Amino Acid Sequence

Protein sequence (Q9BYZ8, Asp23-Pro158, with C-10*His) DIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRPGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 17.6 kDa Observed MW: 56-72 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Regenerating islet-derived protein 4 (Reg4) also called Reg IV or RELP (Reg-like protein), is a secreted glycoprotein belonging to the regenerating gene (Reg) family within the calcium (C‑type) dependent lectin superfamily. Reg4 expression is induced by growth factors and promotes phosphorylation and activation of the EGF R. Reg4 is preferentially expressed in the gastrointestinal (GI) tract. Reg4 expression is increased within or near inflammation, dysplasia and metaplasia of the GI epithelium, such as inflammatory bowel disease (Crohn’s disease and ulcerative colitis), colon adenocarcinoma, pancreatic cancer, gastric adenocarcinoma, and is often increased in the plasma in these conditions. It is especially associated with neuroendocrine tumors in the GI, as well as some prostate, parathyroid, skin Merkel cell and lung small-cell carcinomas. Tumor cells expressing Reg4 are generally more mitogenic, metastatic and resistant to apoptosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 49936164018

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
coach
Port Orchard, US
★★★★★ 5
Love this ball!
Size: Large (Pack of 1), Color: Multi
My doberman and her dog friends love this large high bounce rubber fetch ball! She loves to chew it endlessly between throws and her Rottweiler buddy loves to do the same because it has a hole through it. I definitely recommend the large 3 inch ball for larger dogs.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 15, 2025
M
Verified Purchase
Michael Murrell
Pawtucket, US
★★★★★ 4
The orange ones are perfect!
Size: Medium (Pack of 2), Color: Assorted
I wish I could give 4 1/2 stars but it isn't possible. The reason why I don't give 5 stars is because no one sells these in a 2 pack of just orange balls. I was able to find blue only but not orange only. I have a pitbull and so does my good friend. We take our dogs out all the time and they absolutely love chasing these balls.... The orange ones to be exact. They will not play with or bring the blue balls back. They are a waste. I had to buy 2 packs to keep the oranges. I'm taking the blue ones to the local dog park and just dropping them off. Now to the reason these balls deserve 5 stars: They are super easy to throw and they also make a slight whistling noise when you throw them because of the holes. They are real easy to wash due to the material. Also, they are pretty indestructible. The only reason I'm ordering more is due to them being lost. Our dogs have never torn them apart. I'm sure they could if we let them, but we use these for chase, not as chew toys. My friend also tied a rope through one of the balls to throw and retrieve with the rope. He uses this as a fun indoor toy. These do not float in water but I buy other chuckit balls for that purpose. They have the orange balls with the blue stripe which work great in pools. The balls are awesome and I keep coming back for more. Hopefully your dogs like the blue balls.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 8, 2015
A
Verified Purchase
Auskan
Cuba, US
★★★★★ 5
Worth the money
Size: Medium (Pack of 2), Color: Assorted
I've had several sizes of Chuck-It ball launchers for years but had resisted buying the balls to go with them because I had about 50 tennis balls already that cost only pennies apiece and these were quite a bit more expensive. But, I got tired of the dogs chewing up the tennis balls. I'd start a ball throwing session with a brand new ball and for the first few throws it would sail through the air and the dogs would have to work to retrieve it. However on the way back, their jaws would work it, chomp-chomp-chomp. And when they returned to me, they'd want to stand there and chomp some more, despite my command to "Drop it!" Within 30 minutes, the brand new ball would have a hole in it and then instead of sailing several football fields through the air, then bouncing over a couple of trees, I'd throw it and it would piddle unenthusiastically to the end of the driveway before falling to the ground with a sulky thud, not even bothering to bounce. So - I finally grew tired of going through a ball every time I play with the dogs - which is everyday - and ordered these chuck-it balls. They are the same size as a tennis ball but made of a rubber-like material (not silicone) and after several months of use, have no wear and tear on them at all. The dogs can exercise their gums on them all the way back to me - throw after throw - and the ball still flies the same distance each time, and bounces satisfyingly upon contact with the ground. The description says "colors may vary" but the first packet I ordered were blue and orange as pictured. Unfortunately my dog lost the orange one the first time we used it. She got thirsty and ran down to our pond for a drink, dropped the ball in the pond and it hasn't been seen since. It is dense enough it doesn't float as a tennis ball might, and by now is probably so covered in mud and slime that I wouldn't recognize it if I tripped over it. Lesson learned: we don't throw the ball in the pond pasture any more. After losing the orange ball, I ordered a second packet of the balls so that I would always have a spare. The second packet is also blue and orange. So while colors may vary, in my experience so far, they haven't (which doesn't matter to me or the dogs).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 1, 2015
D
Verified Purchase
Dawn T Conway
Louisville, US
★★★★★ 5
Super Chewer Friendly!!
Size: Large (Pack of 1), Color: Multi
This ball is perfect for the super Chewer!! It is squishy and durable rubber that stands up to the aggressive chewer. It does not squeak. It has great bounce and is a great toy for fetch. Very cute to watching my pup bring the ball back for another throw. The rubber doesn't stick or have an average powering smell. It smells just like a rubber ball. It is highly functional for a great game of fetch! Highly recommend and very happy with our purchase. It is well worth the price. We will be ordering more.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2025
D
Verified Purchase
Dawn
West Palm Beach, US
★★★★★ 5
My dog LOVES these balls
Awesome balls! Soft, squishy, and dog can get their teeth into them but they don’t get damaged. My dog absolutely loves them!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 6, 2026

recommand products