SKU: 97189701491

GCGR Fc Chimera Protein, Human

Sale price$612.00 Regular price$680.00
Save 10%

Pay in installments of $170.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 28 - Aug 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

GCGR Fc Chimera Protein, HumanProduct Specification Species Human Accession P47871 1 Amino Acid Sequence Ala26 Lys136, with C terminal human IgG Fc

Product Specification


Species Human
Accession P47871-1
Amino Acid Sequence

Ala26-Lys136, with C-terminal human IgG Fc AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

57-67 kDa(Reducing)

Purity

>90% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

The glucagon receptor (GCGR) is a Class B GPCR that has an important role in maintenance of glucose homeostasis and, as such, is considered to be a valuable target for the treatment of diabetes. The GCGR is widely expressed and can be found in the liver, adipose tissue, heart, kidney, pancreatic islets, stomach, small intestine, thyroid, and skeletal muscle. The GCGR is coupled to the activation of adenylate cyclase via Gs, with concomitant rise in cellular cyclic AMP levels and activation of protein kinase A (PKA). GCGR mRNA has been detected in islets. In vitro/ex vivo studies suggest that glucagon potentiates insulin secretion from isolated islets, although the potency is considerably less than that of the insulin secretagogue GLP-1. Mutations of the GCGR gene are associated with congenital noninsulin-dependent diabetes, and inhibition of GCGR in vivo lowers blood glucose and improves glucose tolerance in obese diabetic mice.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 97189701491

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
H
Verified Purchase
Honorific Tails
Omaha, US
★★★★★ 3
Cheese the Day with Nylabone's Power Chew Cheese Chew Toy!
Size: X-Large, Color: Cheese
As a devoted dog parent, I've always believed that our furry friends deserve the best, especially when it comes to their favorite pastime—chewing! Nylabone's Power Chew Cheese Chew Toy is a game-changer that's added an extra layer of excitement to our dog's chewing routine. **Chew-Tastic Design:** First things first, the cheese-inspired shape of this chew toy is a hit in our household. Our dog can't resist its quirky design, and it's become a beloved addition to his chew toy collection. It's like a fun surprise every time he reaches for it! **Flavor Pockets for Fun:** What truly sets this chew toy apart is its flavor pockets. We fill them with spreadable treats, turning regular chew time into an epic adventure. Our dog absolutely loves the challenge of getting every last bit of treat, and it keeps him engaged for hours. **Dental Health Bonus:** Beyond the fun factor, the unique textures on this toy serve a dual purpose. Not only do they provide extra sensory enjoyment for our pup, but they also help clean his teeth as he chews. It's a win-win for both entertainment and dental health. **Built to Last:** Now, let's talk durability. Our dog is a power chewer, and this toy has proven to be up to the challenge. Made from Nylabone's most robust material, it's stood the test of time, promoting healthy chewing habits and saving our furniture from destruction. **Satisfaction All Around:** This chew toy isn't just for our dog's enjoyment; it brings joy to our family too. Seeing our furry friend so engaged and happy is priceless. It satisfies his natural urge to chew while teaching him healthy chewing habits. **A Flavorful Experience:** Did I mention the cheese flavor? It runs throughout the toy, adding another layer of enjoyment for our pup. It's like a delicious treat that never ends! **Perfect for Big Dogs:** As the proud parent of an extra-large dog, we opted for the "Souper" size, designed for dogs over 50 pounds. It's the perfect size for our gentle giant. In conclusion, Nylabone's Power Chew Cheese Chew Toy has become an integral part of our dog's life. It's more than just a chew toy; it's an adventure, a dental health solution, and hours of entertainment all rolled into one. We've embraced the mantra of "Cheese the Day" with this fantastic chew toy, and we wholeheartedly recommend it to fellow dog parents looking to add more joy and flair to their furry friend's life!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 27, 2023
D
Verified Purchase
Danielle L Dykhouse
Fort Morgan, US
★★★★★ 5
Dog approved.
Size: X-Large, Color: Cheese
I’m a 70 lbs Goldendoodle (supposed to be 65, don’t ask) and I love cheese. Real cheese. Sharp cheddar with sourdough bread is my dream, but apparently I’m “on a health journey,” so my people bought me this instead. Does this bone actually taste like cheese? No. I am not fooled. Do I still enjoy chewing it loudly while my humans are trying to watch TV? Absolutely yes. This bone satisfies my need to chew and my emotional desire for cheese-adjacent activities. It keeps me busy, saves the furniture, and lets me crunch dramatically during important dialogue scenes. The yellow color is nice — very cheese-coded — although some cheeses are white, so just something to consider for future versions. Also, good news: it doesn’t smell like cheese at all, which my humans seem very grateful for. Apparently they don’t want the carpet to smell like a deli. Weird. Final verdict: Not cheese. Still enjoyable. Would chew again. ~Barley
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 4, 2026
D
Verified Purchase
Dez F.
Pawtucket, US
★★★★★ 5
A Humorous Twist on Tough Dog Toys!
Size: Large, Color: Lobster 3 Pack
I recently purchased the Nylabone Power Chew Dog Toy Pack for Aggressive Chewers from Amazon, and I must say, these toys have been a hilarious hit with my furry friend. As a dog parent of a strong and determined chewer, finding toys that can withstand their chewing prowess is a top priority, and these toys deliver both durability and a touch of humor. The pack consists of three large/giant-sized toys in the shape of a lobster, cheese, and broccoli. The unique and amusing design puts a smile on my face every time I see my dog interacting with them. The unexpected twist brings a playful element to our daily playtime sessions, making it a fun and engaging experience for both of us. When it comes to durability, these toys excel. My dog can be quite aggressive with their chewing, and I've struggled to find toys that can withstand their powerful jaws. However, the Nylabone Power Chew toys have proven to be impressively tough and durable. Despite rigorous chew sessions, these toys have remained intact, with no signs of wear or damage. They provide a reliable outlet for my dog's chewing instincts without the risk of shredding or ingesting any harmful materials. The textured surfaces of these toys add an extra layer of interest for my dog. The ridges and raised bumps provide sensory stimulation, promoting healthy oral hygiene and helping to clean teeth and gums as they chew. I appreciate the added dental benefits these toys offer, as it helps maintain my dog's dental health while they engage in play. I also appreciate the size options available in this pack. Large and giant-sized dogs often require bigger toys to accommodate their larger mouths and chewing strength. The included toys are appropriately sized for larger breeds, ensuring a comfortable grip and maximum enjoyment during play sessions. As a bonus, these toys are made from high-quality, non-toxic materials, so I have peace of mind knowing that my dog can safely interact with them. Safety is a top priority for me, and Nylabone consistently delivers in that regard. In conclusion, if you have an aggressive chewer and are in search of durable, funny, and engaging dog toys, the Nylabone Power Chew Dog Toy Pack is a fantastic choice. These toys provide hours of entertaining play, withstand even the most determined chewers, and offer dental benefits. Embrace the humorous twist and enjoy watching your furry friend engage in safe and engaging play with these fantastic toys. Invest in the Nylabone Power Chew Dog Toy Pack today and let the lobsters, cheese, and broccoli bring laughter and durability to your dog's playtime!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 19, 2023
K
Verified Purchase
Kirstyn Shearer
Massapequa, US
★★★★★ 5
Solid win for any chewing pup!
Size: Small, Color: Broccoli 3 Pack, Size: Small, Color: Broccoli 3 Pack
My pup loves them! Long lasting plus health benefits for his teeth, 10/10 would recommend 💖
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026
S
Verified Purchase
Stef
Cuba, US
★★★★★ 5
Shark dog approved
Size: Large, Color: Broccoli, Size: Large, Color: Broccoli
My new baby shark.... I mean puppy really enjoys chewing. I can't just give her a ton of pig ears or bully sticks all day, which she would definitely love, so I'm constantly looking for well made chew toys. I'd put this right up with Kong. Very durable and nice. I also love the different textures, she seems to also love it. She can gnaw at the top and chew on the stem. She wanted it as soon as I opened it - it does smell like bacon but I haven't taken a chomp at it to be able to write a complete review! My dog is about 23 lbs but I can see a 80 lb dog chew this, it's not small.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 8, 2025

recommand products