SKU: 895112236

Cholera Toxin B subunit (CTB)

Sale price$126.00 Regular price$140.00
Save 10%

Pay in installments of $35.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 29 - Aug 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Cholera Toxin B subunit (CTB)Product Specification Synonyms CHOLERA TOXIN B SUBUNITCTB Cholera Toxin B subunitCTxBCholeragenoid Accession P01556 Amino Acid Sequence MTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN Expression System E. coli Molecular Weight 11. 8kDa(Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <0. 2EU g Conjugation Unconjugated Physical Appearance Lyophilized Powder Storage Buffer 20mM Tris, 100mM

Product Specification


Synonyms CHOLERA TOXIN B SUBUNIT、CTB、 Cholera Toxin B subunit、CTxB、Choleragenoid
Accession P01556
Amino Acid Sequence

MTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN

Expression System E.coli
Molecular Weight

11.8kDa(Reducing)

Purity >95% by SDS-PAGE & RP-HPLC
Endotoxin <0.2EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 100mM NaCl, pH9.0
Reconstitution

Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Cholera toxin (CTB)belongs to the AB5 –subunit family oftoxins.The native hexameric protein has a molecular mass of ~85 kDa and contains two subunits. It consists of a single A subunit (~27.2 kDa), responsible for the ADP-ribosylation activity, and five B subunits(~11.6 kDa each), which are arranged as a pentameric ring with an apparent 5-fold symmetry and are associated with the cell surface receptor binding and subsequent internalization (transmembrane transport)of the enzymatic component.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 895112236

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Be Beautiful
West Palm Beach, US
★★★★★ 5
Glamorize your sunny day outing with this shimmer suntan protection
Color: Glistening Bronze, Color: Glistening Bronze
This body shimmer oil has a natural glow luminizer in it. It has an SPF of 45 for sun protection factor. This went on smoothly and easily and was light and did not feel greasy. It felt like fancy suntan lotion like no other I've ever tried before. This just adds a little glamor to your sunny day outing
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 20, 2026
A
Aimee inman
Carnegie, US
★★★★★ 5
Glowy, Lightweight Summer Shine
Color: Glistening Bronze, Color: Glistening Bronze
This gives a really pretty sun-kissed glow without feeling greasy or heavy on the skin. The shimmer is noticeable but not over-the-top, and it blends nicely for a smooth, radiant finish. I also like that it has SPF, which makes it perfect for everyday summer use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 17, 2026
O
Olive Oil
Chelsea, US
★★★★★ 3
This Oil Definitely Glitters!
Color: Glistening Bronze, Color: Glistening Bronze
I really wanted to love this shimmer oil, but it's unfortunately not my favorite. I love that it has SPF! That is a big win for me! The oil is also very good at hydrating my skin, which I appreciate. My problem comes with the shimmer of the product. The glitter in it is too big for my liking. With it being called a shimmer oil, I expected tiny glitter that softly shimmers like shimmer powders, lotions, and oils usually do. But this stuff glit-ters! And because it's bigger sized glitter, it's a lot easier to see when it gets all over everything like clothes, furniture, spouses and children. If the shimmering glitter in this was just smaller and softer, I would love this for summer time to use on my legs and arms. But it's unfortunately just not my favorite and I don't think I'll be using it anymore.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
W
Verified Purchase
Windy City
Grantham, US
★★★★★ 5
The best Facewipes!
Size: 25 Count (Pack of 1), Style: Makeup Remover Wipes
Excellent face wipes. Gentle, removes makeup easily, no face irritation, no fragrance . Good for travel. Hard to find in the stores near me. I recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
S
Verified Purchase
Sincerely Sherrell
Draper, US
★★★★★ 5
Soft, Effective & Perfect for Daily Makeup Removal!
Size: 25 Count (Pack of 1), Style: Makeup Remover Wipes
I recently started using Cetaphil Gentle Makeup Removing Face Wipes (Daily Cleansing Facial Towelettes), and they’ve quickly become a staple in my skincare routine. If you want a gentle yet effective way to remove makeup at the end of the day, these are fantastic. 💧 Gentle on Skin: These wipes are super soft and feel very soothing on the skin — perfect for sensitive skin like mine. They don’t tug or irritate, even around the delicate eye area. 💄 Effective Makeup Removal: These wipes remove foundation, mascara, eyeliner, and everyday makeup easily. I’ve used them on full-face makeup, and they still do a thorough job without leaving gunky residue. 🌿 Daily Use Friendly: They feel like a gentle cleanse rather than a harsh scrub. My skin feels clean and refreshed afterward, not tight or stripped. 🧼 Convenient & Easy: The towelettes come in a nice, easy-to-open pack that keeps them moist and ready to use anytime — great for travel, late nights, or quick routines. ✨ Non-Irritating Formula: No harsh fragrances or strong chemicals — just clean, balanced cleansing that feels soothing and safe. Overall, Cetaphil Gentle Makeup Removing Face Wipes are a reliable, comfortable, and convenient choice for everyday makeup removal. Highly recommend for anyone who wants effective cleansing without irritation! 🌸🧖‍♀️✨
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 5, 2026

recommand products